PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_29577_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 335aa    MW: 36920.5 Da    PI: 9.2709
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_29577_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.2e-42149226178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C adls+ak+yhrrhkvCe+hska+ +lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Neem_29577_f_1 149 VCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 226
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-34142211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.385147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-39148229IPR004333Transcription factor, SBP-box
PfamPF031101.8E-30150223IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
METRFIGEAH HIYGMNSMDL RAVGKRTLEW DLNDWKWDGD LFIASPLNPV PNDNIGQKFF  60
PLGTGNSSNS SSSCSEEVNL GIEKGKKELE KKRRAIVVED HNSYEAAAGG LTLKLGGNGY  120
PLTEREMGNW AGTSGKKTKF GGGSSRRAVC QVEDCGADLS NAKDYHRRHK VCEMHSKASR  180
ALVGNVMQRF CQQCSRFHVL QEFDEGKRSC RRRLAGHNKR RRKTNPDAVG NGSSLNDDQT  240
SGYLLISILR ILSNMHSNRS DQRTDQDLLS HLLRSLANPA GENGGRGISG LLQEPQDMLT  300
DRTSVGNSEV VSAMLANGQG TPGPFRQPLT AMMKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-33143223484squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4738611e-50AM473861.2 Vitis vinifera contig VV78X120549.12, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015380668.10.0PREDICTED: LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 1
SwissprotQ9S7P51e-95SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A067H7A90.0A0A067H7A9_CITSI; Uncharacterized protein
STRINGPOPTR_0002s18970.11e-152(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-74squamosa promoter binding protein-like 1